Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 2
LigandBDBM29589
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1591001
IC50 2.0±n/a nM
Citation Wagner FFWeïwer MSteinbacher SSchomburg AReinemer PGale JPCampbell AJFisher SLZhao WNReis SAHennig KMThomas MMüller PJefson MRFass DMHaggarty SJZhang YLHolson EB Kinetic and structural insights into the binding of histone deacetylase 1 and 2 (HDAC1, 2) inhibitors. Bioorg Med Chem 24:4008-4015 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 2
Name:Histone deacetylase 2
Synonyms:HD2 | HDAC2 | Histone deacetylase 2 (HDAC2) | Human HDAC2
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:55356.54
Organism:Homo sapiens (Human)
Description:The assay was performed using isolated HDAC2 that had been expressed as full-length 6x His-tagged fusion proteins in a baculovirus expression system in Sf9 cells.
Residue:488
Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29589
n/a
NameBDBM29589
Synonyms:Faridak | LBH-589 | LBH-589B | Panobinostat
TypeSmall organic molecule
Emp. Form.C21H23N3O2
Mol. Mass.349.4262
SMILESCc1[nH]c2ccccc2c1CCNCc1ccc(\C=C\C(=O)NO)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: