| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50190620 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1589520 (CHEMBL3829094) |
|---|
| Ki | 5.7±n/a nM |
|---|
| Citation |  Scocchera, E; Reeve, SM; Keshipeddy, S; Lombardo, MN; Hajian, B; Sochia, AE; Alverson, JB; Priestley, ND; Anderson, AC; Wright, DL Charged Nonclassical Antifolates with Activity Against Gram-Positive and Gram-Negative Pathogens. ACS Med Chem Lett7:692-6 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 17532.46 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 157 |
|---|
| Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
|---|
| BDBM50190620 |
|---|
| n/a |
|---|
| Name | BDBM50190620 |
|---|
| Synonyms: | CHEMBL3828724 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23F3N4O5 |
|---|
| Mol. Mass. | 516.4691 |
|---|
| SMILES | OC(=O)C(F)(F)F.CCc1nc(N)nc(N)c1C#CCc1cc(ccc1OC)-c1cccc(c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
