Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-ACP Reductase (InhA)
LigandBDBM50191274
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1612658
IC50 7690±n/a nM
Citation Joshi SDKumar DDixit SRTigadi NMore UALherbet CAminabhavi TMYang KS Synthesis, characterization and antitubercular activities of novel pyrrolyl hydrazones and their Cu-complexes. Eur J Med Chem 121:21-39 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Enoyl-ACP Reductase (InhA)
Name:Enoyl-ACP Reductase (InhA)
Synonyms:Enoyl-[acyl-carrier-protein] reductase | NADH-dependent enoyl-ACP reductase
Type:Enzyme
Mol. Mass.:28526.00
Organism:Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Description:P9WGR1
Residue:269
Sequence:
MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50191274
n/a
NameBDBM50191274
Synonyms:CHEMBL3956359
TypeSmall organic molecule
Emp. Form.C22H21FN4O2
Mol. Mass.392.4261
SMILESC\C(CCC(=O)Nc1ccc(F)cc1)=N/NC(=O)c1ccc(cc1)-n1cccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: