Reaction Details |
| Report a problem with these data |
Target | Iron-starvation protein PigA |
---|
Ligand | BDBM50191307 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1612785 (CHEMBL3854585) |
---|
Kd | 6700±n/a nM |
---|
Citation | Heinzl, GA; Huang, W; Yu, W; Giardina, BJ; Zhou, Y; MacKerell, AD; Wilks, A; Xue, F Iminoguanidines as Allosteric Inhibitors of the Iron-Regulated Heme Oxygenase (HemO) of Pseudomonas aeruginosa. J Med Chem59:6929-42 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Iron-starvation protein PigA |
---|
Name: | Iron-starvation protein PigA |
Synonyms: | Heme oxygenase | Iron-starvation protein PigA |
Type: | PROTEIN |
Mol. Mass.: | 21946.19 |
Organism: | Pseudomonas aeruginosa |
Description: | ChEMBL_444781 |
Residue: | 198 |
Sequence: | MDTLAPESTRQNLRSQRLNLLTNEPHQRLESLVKSKEPFASRDNFARFVAAQYLFQHDLE
PLYRNEALARLFPGLASRARDDAARADLADLGHPVPEGDQSVREADLSLAEALGWLFVSE
GSKLGAAFLFKKAAALELDENFGARHLAEPEGGRAQGWKSFVAILDGIELNEEEERLAAK
GASDAFNRFGDLLERTFA
|
|
|
BDBM50191307 |
---|
n/a |
---|
Name | BDBM50191307 |
Synonyms: | CHEMBL3900440 |
Type | Small organic molecule |
Emp. Form. | C8H10BrClN4 |
Mol. Mass. | 277.549 |
SMILES | Cl.[#7]\[#6](-[#7])=[#7]\[#7]=[#6]\c1ccccc1Br |
Structure |
|