| Reaction Details |
|---|
 | Report a problem with these data |
| Target | D(3) dopamine receptor |
|---|
| Ligand | BDBM50192450 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1613477 (CHEMBL3855277) |
|---|
| Ki | 0.575440±n/a nM |
|---|
| Citation |  Micheli, F; Bacchi, A; Braggio, S; Castelletti, L; Cavallini, P; Cavanni, P; Cremonesi, S; Dal Cin, M; Feriani, A; Gehanne, S; Kajbaf, M; Marchió, L; Nola, S; Oliosi, B; Pellacani, A; Perdoną, E; Sava, A; Semeraro, T; Tarsi, L; Tomelleri, S; Wong, A; Visentini, F; Zonzini, L; Heidbreder, C 1,2,4-Triazolyl 5-Azaspiro[2.4]heptanes: Lead Identification and Early Lead Optimization of a New Series of Potent and Selective Dopamine D3 Receptor Antagonists. J Med Chem59:8549-76 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| D(3) dopamine receptor |
|---|
| Name: | D(3) dopamine receptor |
|---|
| Synonyms: | DOPAMINE D3 | DRD3 | DRD3_HUMAN | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 44243.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 400 |
|---|
| Sequence: | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
|
|
|
|---|
| BDBM50192450 |
|---|
| n/a |
|---|
| Name | BDBM50192450 |
|---|
| Synonyms: | CHEMBL3896638 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H25F3N4S2 |
|---|
| Mol. Mass. | 478.597 |
|---|
| SMILES | Cn1c(SCCCN2CC[C@]3(C[C@@H]3c3ccc(cc3)C(F)(F)F)C2)nnc1-c1ccsc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
