Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVitamin K-dependent protein C
LigandBDBM50192771
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1613700
Ki 70±n/a nM
Citation Ladziata VUGlunz PWZou YZhang XJiang WJacutin-Porte SCheney DLWei ALuettgen JMHarper TMWong PCSeiffert DWexler RRPriestley ES Synthesis and P1' SAR exploration of potent macrocyclic tissue factor-factor VIIa inhibitors. Bioorg Med Chem Lett 26:5051-5057 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vitamin K-dependent protein C
Name:Vitamin K-dependent protein C
Synonyms:Activated protein C cofactor | Anticoagulant protein C | Apolipoprotein H | Autoprothrombin IIA | Blood coagulation factor XIV | Coagulation factor V | Coagulation factor V heavy chain | Coagulation factor V light chain | Endothelial protein C receptor | Proaccelerin, labile factor | Vitamin K-dependent protein C precursor
Type:Enzyme
Mol. Mass.:52067.73
Organism:Homo sapiens (Human)
Description:n/a
Residue:461
Sequence:
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50192771
n/a
NameBDBM50192771
Synonyms:CHEMBL3898371
TypeSmall organic molecule
Emp. Form.C34H34FN5O5
Mol. Mass.611.6627
SMILES[H][C@]1(C)COC(=O)Nc2ccc(c(CN(C)C(=O)[C@]([H])(Nc3ccc4c(c3)c(F)c[nH]c4=N)c3ccc1c(C)c3)c2)C1(CC1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: