Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein 1
LigandBDBM50192764
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1613699
Ki 15±n/a nM
Citation Ladziata VUGlunz PWZou YZhang XJiang WJacutin-Porte SCheney DLWei ALuettgen JMHarper TMWong PCSeiffert DWexler RRPriestley ES Synthesis and P1' SAR exploration of potent macrocyclic tissue factor-factor VIIa inhibitors. Bioorg Med Chem Lett 26:5051-5057 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kallikrein 1
Name:Kallikrein 1
Synonyms:Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein
Type:Enzyme
Mol. Mass.:28874.69
Organism:Homo sapiens (Human)
Description:P06870
Residue:262
Sequence:
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50192764
n/a
NameBDBM50192764
Synonyms:CHEMBL3934882
TypeSmall organic molecule
Emp. Form.C33H34FN5O3
Mol. Mass.567.6532
SMILESC[C@H]1COC(=O)Nc2ccc(C3CC3)c(CN(C)C(=O)[C@H](Nc3ccc4c(N)ncc(F)c4c3)c3ccc1c(C)c3)c2 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: