Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstrogen-related receptor gamma
LigandBDBM50193253
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1615017
IC50 20±n/a nM
Citation Kim JChin JIm CYYoo EKWoo SHwang HJCho JHSeo KASong JHwang HKim KHKim NDYoon SKJeon JHYoon SYJeon YHChoi HSLee IKKim SHCho SJ Synthesis and biological evaluation of novel 4-hydroxytamoxifen analogs as estrogen-related receptor gamma inverse agonists. Eur J Med Chem 120:338-52 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estrogen-related receptor gamma
Name:Estrogen-related receptor gamma
Synonyms:ERR gamma-2 | Estrogen receptor-related protein 3 | Nuclear receptor subfamily 3 group B member 3
Type:PROTEIN
Mol. Mass.:51305.00
Organism:Homo sapiens (Human)
Description:ChEMBL_1501351
Residue:458
Sequence:
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193253
n/a
NameBDBM50193253
Synonyms:CHEMBL3961676
TypeSmall organic molecule
Emp. Form.C27H31ClFNO2
Mol. Mass.455.992
SMILESCl.CN(C)CCOc1ccc(cc1)C(=C(\CCCF)c1ccccc1)\c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: