Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50193284
Substrate/Competitorn/a
Meas. Tech.ChEBML_1615640
Ki 3.6±n/a nM
Citation Lazzari PDistinto RManca IBaillie GMurineddu GPira MFalzoi MSani MMorales PRoss RZanda MJagerovic NPinna GA A critical review of both the synthesis approach and the receptor profile of the 8-chloro-1-(2',4'-dichlorophenyl)-N-piperidin-1-yl-1,4,5,6-tetrahydrobenzo[6,7]cyclohepta[1,2-c]pyrazole-3-carboxamide and analogue derivatives. Eur J Med Chem 121:194-208 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor
Type:Enzyme
Mol. Mass.:52842.52
Organism:Mus musculus (Mouse)
Description:P47746
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193284
n/a
NameBDBM50193284
Synonyms:CHEMBL3978981
TypeSmall organic molecule
Emp. Form.C29H30Cl3N3O
Mol. Mass.542.927
SMILESCC1(C)C2CC1C(CNC(=O)c1nn(c-3c1CCCc1cc(Cl)ccc-31)-c1ccc(Cl)cc1Cl)CC2
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: