Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50045776
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1615868
Ki 16±n/a nM
Citation Talele TT The"Cyclopropyl Fragment" is a Versatile Player that Frequently Appears in Preclinical/Clinical Drug Molecules. J Med Chem 59:8712-8756 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Delta-type opioid receptor
Synonyms:D-OR-1 | DOR-1 | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRK1 | opioid receptor, delta 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40382.98
Organism:Homo sapiens (Human)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor.
Residue:372
Sequence:
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50045776
n/a
NameBDBM50045776
Synonyms:CHEMBL982 | JF-1 | NALMEFENE | Nalmetrene | ORF-11676 | Revex | cid_5284594
TypeSmall organic molecule
Emp. Form.C21H25NO3
Mol. Mass.339.4281
SMILESOc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)C(=C)CC[C@@]35O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: