Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50194190 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1616436 (CHEMBL3858505) |
---|
IC50 | 1.000000±n/a nM |
---|
Citation | Kuklish, SL; Antonysamy, S; Bhattachar, SN; Chandrasekhar, S; Fisher, MJ; Fretland, AJ; Gooding, K; Harvey, A; Hughes, NE; Luz, JG; Manninen, PR; McGee, JE; Navarro, A; Norman, BH; Partridge, KM; Quimby, SJ; Schiffler, MA; Sloan, AV; Warshawsky, AM; York, JS; Yu, XP Characterization of 3,3-dimethyl substituted N-aryl piperidines as potent microsomal prostaglandin E synthase-1 inhibitors. Bioorg Med Chem Lett26:4824-4828 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50194190 |
---|
n/a |
---|
Name | BDBM50194190 |
Synonyms: | CHEMBL3956184 |
Type | Small organic molecule |
Emp. Form. | C25H35N3O2 |
Mol. Mass. | 409.5643 |
SMILES | Cc1cccc2ccc(nc12)N1CC[C@H](C(=O)N[C@H]2CCC[C@H](CO)C2)C(C)(C)C1 |r| |
Structure |
|