Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChromobox protein homolog 8
LigandBDBM50194463
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1616629
IC50 47000±n/a nM
Citation Stuckey JISimpson CNorris-Drouin JLCholensky SHLee JPasca RCheng NDickson BMPearce KHFrye SVJames LI Structure-Activity Relationships and Kinetic Studies of Peptidic Antagonists of CBX Chromodomains. J Med Chem 59:8913-8923 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chromobox protein homolog 8
Name:Chromobox protein homolog 8
Synonyms:CBX8 | PC3 | Pc3 | Polycomb 3 homolog | RC1 | Rectachrome 1 | hPc3
Type:PROTEIN
Mol. Mass.:43415.86
Organism:Homo sapiens (Human)
Description:ChEMBL_108272
Residue:389
Sequence:
MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
EREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRA
REGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERER
GTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGK
FPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGAL
DPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEK
VVVTDVTSNFLTVTIKESNTDQGFFKEKR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50194463
n/a
NameBDBM50194463
Synonyms:CHEMBL3974828
TypeSmall organic molecule
Emp. Form.C41H61N7O9
Mol. Mass.795.9645
SMILESCCN(CC)CCCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)c1ccccc1)C(=O)N[C@@H](CO)C(=O)OC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: