Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChromobox protein homolog 8
LigandBDBM50194254
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1616629
IC50>60000±n/a nM
Citation Stuckey JISimpson CNorris-Drouin JLCholensky SHLee JPasca RCheng NDickson BMPearce KHFrye SVJames LI Structure-Activity Relationships and Kinetic Studies of Peptidic Antagonists of CBX Chromodomains. J Med Chem 59:8913-8923 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chromobox protein homolog 8
Name:Chromobox protein homolog 8
Synonyms:CBX8 | PC3 | Pc3 | Polycomb 3 homolog | RC1 | Rectachrome 1 | hPc3
Type:PROTEIN
Mol. Mass.:43415.86
Organism:Homo sapiens (Human)
Description:ChEMBL_108272
Residue:389
Sequence:
MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
EREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRA
REGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERER
GTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGK
FPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGAL
DPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEK
VVVTDVTSNFLTVTIKESNTDQGFFKEKR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50194254
n/a
NameBDBM50194254
Synonyms:CHEMBL3908012
TypeSmall organic molecule
Emp. Form.C44H64N8O9
Mol. Mass.849.0272
SMILESCOC(=O)[C@H](CO)NC(=O)[C@H](CCCCNC1CN2CCC1CC2)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)c1ccccc1 |r,wU:40.42,27.29,4.4,wD:35.37,10.10,(30.05,-20.96,;28.71,-20.19,;27.38,-20.97,;27.39,-22.51,;26.05,-20.2,;26.04,-18.66,;27.37,-17.89,;24.72,-20.98,;23.38,-20.21,;23.37,-18.67,;22.05,-20.99,;22.05,-22.53,;23.39,-23.29,;23.4,-24.83,;24.73,-25.6,;24.74,-27.14,;26.08,-27.9,;26.07,-29.44,;27.4,-30.2,;28.74,-29.44,;28.73,-27.89,;27.4,-27.12,;28.02,-28.16,;28.02,-29.32,;20.71,-20.22,;19.38,-21,;19.39,-22.54,;18.04,-20.23,;18.04,-18.69,;19.37,-17.92,;19.36,-16.38,;20.71,-18.68,;16.71,-21.01,;15.38,-20.24,;15.37,-18.7,;14.05,-21.02,;14.05,-22.56,;12.71,-20.25,;11.38,-21.03,;11.39,-22.57,;10.04,-20.26,;10.03,-18.72,;9.28,-17.38,;10.07,-16.06,;9.32,-14.72,;7.77,-14.7,;6.99,-16.03,;7.75,-17.37,;8.71,-21.04,;7.38,-20.27,;7.37,-18.73,;6.04,-21.05,;4.71,-20.28,;3.38,-21.06,;3.38,-22.6,;2.04,-20.29,;2.04,-18.75,;.71,-17.99,;-.64,-18.76,;-.62,-20.31,;.72,-21.07,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: