Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-arginine N-methyltransferase 1
LigandBDBM178103
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1616968
IC50 4.0±n/a nM
Citation Shen YSzewczyk MMEram MSSmil DKaniskan HÜde Freitas RFSenisterra GLi FSchapira MBrown PJArrowsmith CHBarsyte-Lovejoy DLiu JVedadi MJin J Discovery of a Potent, Selective, and Cell-Active Dual Inhibitor of Protein Arginine Methyltransferase 4 and Protein Arginine Methyltransferase 6. J Med Chem 59:9124-9139 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-arginine N-methyltransferase 1
Name:Protein-arginine N-methyltransferase 1
Synonyms:Protein arginine N-methyltransferase 1 (PRMT1) | Protein arginine methyltransferase 1 (PRMT1)
Type:Protein
Mol. Mass.:41506.52
Organism:Homo sapiens (Human)
Description:n/a
Residue:361
Sequence:
MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIV
KANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGL
IFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNAC
LIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYT
HWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRM
R
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178103
n/a
NameBDBM178103
Synonyms:MS023 (Compound 3) | N1-((4-(4-isopropoxyphenyl)-1H-pyrrol-3-yl)methyl)-N1-methylethane-1,2-diamine
TypeSmall organic molecule
Emp. Form.C17H25N3O
Mol. Mass.287.3999
SMILESCC(C)Oc1ccc(cc1)-c1c[nH]cc1CN(C)CCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: