Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine N-methyltransferase 8
LigandBDBM50194756
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1616980
IC50 1600±n/a nM
Citation Shen YSzewczyk MMEram MSSmil DKaniskan HÜde Freitas RFSenisterra GLi FSchapira MBrown PJArrowsmith CHBarsyte-Lovejoy DLiu JVedadi MJin J Discovery of a Potent, Selective, and Cell-Active Dual Inhibitor of Protein Arginine Methyltransferase 4 and Protein Arginine Methyltransferase 6. J Med Chem 59:9124-9139 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine N-methyltransferase 8
Name:Protein arginine N-methyltransferase 8
Synonyms:HRMT1L3 | HRMT1L4 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4 | PRMT8 | Protein arginine N-methyltransferase 8 | Protein arginine N-methyltransferase 8 (PRMT8)
Type:Protein
Mol. Mass.:45293.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:394
Sequence:
MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGK
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGS
GTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVD
IIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWE
NVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM
KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50194756
n/a
NameBDBM50194756
Synonyms:CHEMBL3961701
TypeSmall organic molecule
Emp. Form.C15H24N2O
Mol. Mass.248.3639
SMILESCNCCN1CCC(CC1)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: