Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha adrenergic receptor 1A and 1B
LigandBDBM50160154
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1617626
IC50 90±n/a nM
Citation Guo DLi JLin HZhou YChen YZhao FSun HZhang DLi HShoichet BKShan LZhang WXie XJiang HLiu H Design, Synthesis, and Biological Evaluation of Novel Tetrahydroprotoberberine Derivatives (THPBs) as Selectivea J Med Chem 59:9489-9502 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha adrenergic receptor 1A and 1B
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1 Adrenergic Receptor | Alpha-1Adrenoceptor | Alpha-1B adrenergic receptor | Alpha-1B adrenoreceptor | adrenergic Alpha1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:56606.71
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat cortical membranes.
Residue:515
Sequence:
MNPDLDTGHNTSAPAHWGELKDDNFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRGGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGTQRTLP
SASPSPGYLGRGTQPPVELCAFPEWKPGALLSLPEPPGRRGRLDSGPLFTFKLLGDPESP
GTEGDTSNGGCDTTTDLANGQPGFKSNMPLAPGHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160154
n/a
NameBDBM50160154
Synonyms:1-(3-Hydroxy-propyl)-5-((R)-2-{2-[2-(2,2,2-trifluoro-ethoxy)-phenoxy]-ethylamino}-propyl)-2,3-dihydro-1H-indole-7-carboxylic acid amide | CHEMBL24778 | SILODOSIN
TypeSmall organic molecule
Emp. Form.C25H32F3N3O4
Mol. Mass.495.5345
SMILESC[C@H](Cc1cc2CCN(CCCO)c2c(c1)C(N)=O)NCCOc1ccccc1OCC(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: