Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 1 |
---|
Ligand | BDBM50195309 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1617651 (CHEMBL3859720) |
---|
Ki | 140±n/a nM |
---|
Citation | Wang, M; Tian, W; Wang, C; Lu, S; Yang, C; Wang, J; Song, Y; Zhou, Y; Zhu, J; Li, Z; Zheng, C Design, synthesis, and activity evaluation of selective inhibitors of anti-apoptotic Bcl-2 proteins: The effects on the selectivity of the P1 pockets in the active sites. Bioorg Med Chem Lett26:5207-5211 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 1 |
---|
Name: | Bcl-2-like protein 1 |
Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
Type: | Mitochondrion membrane; Single-pass membrane protein |
Mol. Mass.: | 26039.60 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 233 |
Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
BDBM50195309 |
---|
n/a |
---|
Name | BDBM50195309 |
Synonyms: | CHEMBL3900077 |
Type | Small organic molecule |
Emp. Form. | C30H26N4O6S2 |
Mol. Mass. | 602.681 |
SMILES | [O-][N+](=O)c1cc(ccc1NCCSc1ccccc1)S(=O)(=O)NC(=O)c1ccc(NC(=O)\C=C\c2ccccc2)cc1 |
Structure |
|