Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM21447 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1617650 (CHEMBL3859719) |
---|
Ki | 1.000000±n/a nM |
---|
Citation | Wang, M; Tian, W; Wang, C; Lu, S; Yang, C; Wang, J; Song, Y; Zhou, Y; Zhu, J; Li, Z; Zheng, C Design, synthesis, and activity evaluation of selective inhibitors of anti-apoptotic Bcl-2 proteins: The effects on the selectivity of the P1 pockets in the active sites. Bioorg Med Chem Lett26:5207-5211 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM21447 |
---|
n/a |
---|
Name | BDBM21447 |
Synonyms: | 4-(4-{[2-(4-chlorophenyl)phenyl]methyl}piperazin-1-yl)-N-[(4-{[(2R)-4-(dimethylamino)-1-(phenylsulfanyl)butan-2-yl]amino}-3-nitrobenzene)sulfonyl]benzamide | ABT-737 | CHEMBL376408 | N-Benylpiperazine derivative, 2 | US11760752, Compound ABT-737 | US9125913, ABT-737 |
Type | Small organic molecule |
Emp. Form. | C42H45ClN6O5S2 |
Mol. Mass. | 813.427 |
SMILES | CN(C)CC[C@H](CSc1ccccc1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)NC(=O)c1ccc(cc1)N1CCN(Cc2ccccc2-c2ccc(Cl)cc2)CC1 |r| |
Structure |
|