| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sodium/hydrogen exchanger isoform 3 |
|---|
| Ligand | BDBM50196789 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1618874 (CHEMBL3861043) |
|---|
| IC50 | 7.8±n/a nM |
|---|
| Citation |  Rackelmann, N; Matter, H; Englert, H; Follmann, M; Maier, T; Weston, J; Arndt, P; Heyse, W; Mertsch, K; Wirth, K; Bialy, L Discovery and Optimization of 1-Phenoxy-2-aminoindanes as Potent, Selective, and Orally Bioavailable Inhibitors of the Na J Med Chem59:8812-8829 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sodium/hydrogen exchanger isoform 3 |
|---|
| Name: | Sodium/hydrogen exchanger isoform 3 |
|---|
| Synonyms: | NHE3 | Sodium/hydrogen exchanger isoform 3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15783.83 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_116993 |
|---|
| Residue: | 140 |
|---|
| Sequence: | KYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVDPLIWKWNTAFVLLTLVFISV
YRVIGVVLQTWILNRYRMVQLEIIDQVVMSYGGLRGAVAFALVVLLDENKVKEKNLFVST
TLIVIFFTVIVQGLTIKPLV
|
|
|
|---|
| BDBM50196789 |
|---|
| n/a |
|---|
| Name | BDBM50196789 |
|---|
| Synonyms: | CHEMBL3892788 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H24Cl3FN4O2 |
|---|
| Mol. Mass. | 513.82 |
|---|
| SMILES | Cl.Cc1nnc(C)n1-c1ccc(O[C@@H]2[C@H](Cc3c2cc(Cl)cc3Cl)N2CC[C@@H](O)C2)c(F)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
