Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein 5 |
---|
Ligand | BDBM50197089 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1619187 (CHEMBL3861356) |
---|
Ki | 167±n/a nM |
---|
Citation | Kühne, H; Obst-Sander, U; Kuhn, B; Conte, A; Ceccarelli, SM; Neidhart, W; Rudolph, MG; Ottaviani, G; Gasser, R; So, SS; Li, S; Zhang, X; Gao, L; Myers, M Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors. Bioorg Med Chem Lett26:5092-5097 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein 5 |
---|
Name: | Fatty acid-binding protein 5 |
Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
Type: | Enzyme |
Mol. Mass.: | 15164.79 |
Organism: | Homo sapiens (Human) |
Description: | Q01469 |
Residue: | 135 |
Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
BDBM50197089 |
---|
n/a |
---|
Name | BDBM50197089 |
Synonyms: | CHEMBL3889982 |
Type | Small organic molecule |
Emp. Form. | C22H19ClN4O2 |
Mol. Mass. | 406.865 |
SMILES | Clc1ccc2nc(N3CCCCC3)c(-c3n[nH]c(=O)o3)c(-c3ccccc3)c2c1 |
Structure |
|