| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein 5 |
|---|
| Ligand | BDBM50197092 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1619187 (CHEMBL3861356) |
|---|
| Ki | 1200±n/a nM |
|---|
| Citation |  Kühne, H; Obst-Sander, U; Kuhn, B; Conte, A; Ceccarelli, SM; Neidhart, W; Rudolph, MG; Ottaviani, G; Gasser, R; So, SS; Li, S; Zhang, X; Gao, L; Myers, M Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors. Bioorg Med Chem Lett26:5092-5097 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein 5 |
|---|
| Name: | Fatty acid-binding protein 5 |
|---|
| Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 15164.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01469 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
|---|
| BDBM50197092 |
|---|
| n/a |
|---|
| Name | BDBM50197092 |
|---|
| Synonyms: | CHEMBL3947458 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16ClNO2 |
|---|
| Mol. Mass. | 325.789 |
|---|
| SMILES | CC(C)c1nc2ccc(Cl)cc2c(-c2ccccc2)c1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
