| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, adipocyte |
|---|
| Ligand | BDBM50197088 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1619186 (CHEMBL3861355) |
|---|
| Ki | 16±n/a nM |
|---|
| Citation |  Kühne, H; Obst-Sander, U; Kuhn, B; Conte, A; Ceccarelli, SM; Neidhart, W; Rudolph, MG; Ottaviani, G; Gasser, R; So, SS; Li, S; Zhang, X; Gao, L; Myers, M Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors. Bioorg Med Chem Lett26:5092-5097 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, adipocyte |
|---|
| Name: | Fatty acid-binding protein, adipocyte |
|---|
| Synonyms: | A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | FABP4 | FABP4_HUMAN | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4 | Fatty acid-binding protein 4 (FABP4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 14719.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P15090 |
|---|
| Residue: | 132 |
|---|
| Sequence: | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
|
|
|
|---|
| BDBM50197088 |
|---|
| n/a |
|---|
| Name | BDBM50197088 |
|---|
| Synonyms: | CHEMBL3979347 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21ClN2O2 |
|---|
| Mol. Mass. | 368.857 |
|---|
| SMILES | CC(C)c1cccc(c1)-c1c(C(O)=O)c(nc2ccc(Cl)cc12)N(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
