Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target17-beta-hydroxysteroid dehydrogenase 14
LigandBDBM50197842
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1619749
Ki 36±n/a nM
Citation Braun FBertoletti NMöller GAdamski JSteinmetzer TSalah MAbdelsamie ASvan Koppen CJHeine AKlebe GMarchais-Oberwinkler S First Structure-Activity Relationship of 17ß-Hydroxysteroid Dehydrogenase Type 14 Nonsteroidal Inhibitors and Crystal Structures in Complex with the Enzyme. J Med Chem 59:10719-10737 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
17-beta-hydroxysteroid dehydrogenase 14
Name:17-beta-hydroxysteroid dehydrogenase 14
Synonyms:17-beta-HSD 14 | 17-beta-hydroxysteroid dehydrogenase 14 | 17-beta-hydroxysteroid dehydrogenase DHRS10 | DHRS10 | Dehydrogenase/reductase SDR family member 10 | HSD17B14 | Retinal short-chain dehydrogenase/reductase retSDR3 | SDR3 | SDR47C1 | Short chain dehydrogenase/reductase family 47C member 1
Type:PROTEIN
Mol. Mass.:28316.15
Organism:Homo sapiens (Human)
Description:ChEMBL_114829
Residue:270
Sequence:
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFIL
CDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYT
LTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVN
CISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTG
IELLVTGGAELGYGCKASRSTPVDAPDIPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50197842
n/a
NameBDBM50197842
Synonyms:CHEMBL3922253
TypeSmall organic molecule
Emp. Form.C18H11F2NO3
Mol. Mass.327.2816
SMILESOc1ccc(cc1F)-c1cccc(n1)C(=O)c1ccc(F)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: