Reaction Details |
| Report a problem with these data |
Target | CDGSH iron-sulfur domain-containing protein 1 |
---|
Ligand | BDBM50198899 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1620948 (CHEMBL3863231) |
---|
Ki | 125±n/a nM |
---|
Citation | Geldenhuys, WJ; Yonutas, HM; Morris, DL; Sullivan, PG; Darvesh, AS; Leeper, TC Identification of small molecules that bind to the mitochondrial protein mitoNEET. Bioorg Med Chem Lett26:5350-5353 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
CDGSH iron-sulfur domain-containing protein 1 |
---|
Name: | CDGSH iron-sulfur domain-containing protein 1 |
Synonyms: | C10orf70 | CISD1 | CISD1_HUMAN | MitoNEET | ZCD1 |
Type: | PROTEIN |
Mol. Mass.: | 12206.48 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_766432 |
Residue: | 108 |
Sequence: | MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAF
DMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
|
|
|
BDBM50198899 |
---|
n/a |
---|
Name | BDBM50198899 |
Synonyms: | CHEMBL3956710 |
Type | Small organic molecule |
Emp. Form. | C10H4Br2ClNOS2 |
Mol. Mass. | 413.536 |
SMILES | Clc1cc(Br)c(\C=C2/SC(=S)NC2=O)cc1Br |
Structure |
|