Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFactor D
LigandBDBM50201569
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1623111
Kd 2210±n/a nM
Citation Yang CYPhillips JGStuckey JABai LSun HDelproposto JBrown WCChinnaswamy K Buried Hydrogen Bond Interactions Contribute to the High Potency of Complement Factor D Inhibitors. ACS Med Chem Lett 7:1092-1096 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Factor D
Name:Complement factor D
Synonyms:Adipsin | C3 convertase activator | CFD | Complement Factor D | DF | PFD | Properdin factor D
Type:Protein
Mol. Mass.:27039.19
Organism:Homo sapiens (Human)
Description:P00746
Residue:253
Sequence:
MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50201569
n/a
NameBDBM50201569
Synonyms:CHEMBL3924715
TypeSmall organic molecule
Emp. Form.C18H16BrN5O2S
Mol. Mass.446.321
SMILESBrc1cccc(NC(=O)[C@@H]2SCCN2C(=O)Cn2ncc3ccccc23)n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: