| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D |
|---|
| Ligand | BDBM50201569 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1623115 (CHEMBL3865467) |
|---|
| IC50 | 77±n/a nM |
|---|
| Citation |  Yang, CY; Phillips, JG; Stuckey, JA; Bai, L; Sun, H; Delproposto, J; Brown, WC; Chinnaswamy, K Buried Hydrogen Bond Interactions Contribute to the High Potency of Complement Factor D Inhibitors. ACS Med Chem Lett7:1092-1096 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D |
|---|
| Name: | Complement factor D |
|---|
| Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27039.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
|---|
| BDBM50201569 |
|---|
| n/a |
|---|
| Name | BDBM50201569 |
|---|
| Synonyms: | CHEMBL3924715 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16BrN5O2S |
|---|
| Mol. Mass. | 446.321 |
|---|
| SMILES | Brc1cccc(NC(=O)[C@@H]2SCCN2C(=O)Cn2ncc3ccccc23)n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
