Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 2
LigandBDBM50201999
Substrate/Competitorn/a
Meas. Tech.ChEBML_1623657
IC50 15±n/a nM
Citation Lee HYChang CYSu CJHuang HLMehndiratta SChao YHHsu CMKumar SSung TYHuang YZLi YHYang CRLiou JP 2-(Phenylsulfonyl)quinoline N-hydroxyacrylamides as potent anticancer agents inhibiting histone deacetylase. Eur J Med Chem 122:92-101 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 2
Name:Histone deacetylase 2
Synonyms:HD2 | HDAC2 | Histone deacetylase 2 (HDAC2) | Human HDAC2
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:55356.54
Organism:Homo sapiens (Human)
Description:The assay was performed using isolated HDAC2 that had been expressed as full-length 6x His-tagged fusion proteins in a baculovirus expression system in Sf9 cells.
Residue:488
Sequence:
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50201999
n/a
NameBDBM50201999
Synonyms:CHEMBL3925939
TypeSmall organic molecule
Emp. Form.C18H13FN2O4S
Mol. Mass.372.37
SMILESONC(=O)\C=C\c1cccc(c1)S(=O)(=O)c1ccc2cccc(F)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: