Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-lysine N-methyltransferase EHMT2
LigandBDBM50202440
Substrate/Competitorn/a
Meas. Tech.ChEBML_1624147
IC50 6500±n/a nM
Citation Kondengaden SMLuo LFHuang KZhu MZang LBataba EWang RLuo CWang BLi KKWang PG Discovery of novel small molecule inhibitors of lysine methyltransferase G9a and their mechanism in leukemia cell lines. Eur J Med Chem 122:382-393 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-lysine N-methyltransferase EHMT2
Name:Histone-lysine N-methyltransferase EHMT2
Synonyms:Bat8 | Ehmt2 | Euchromatic histone-lysine N-methyltransferase 2 | G9a | H3-K9-HMTase 3 | HLA-B-associated transcript 8 | Histone H3-K9 methyltransferase 3 | Ng36 | Protein G9a
Type:PROTEIN
Mol. Mass.:138019.66
Organism:Mus musculus
Description:ChEMBL_1294296
Residue:1263
Sequence:
MRGLPRGRGLMRARGRGRAAPTGGRGRGRGGAHRGRGRPRSLLSLPRAQASWAPQLPAGL
TGPPVPCLPSQGEAPAEMGALLLEKEPRGAAERVHSSLGDTPQSEETLPKANPDSLEPAG
PSSPASVTVTVGDEGADTPVGAASLIGDEPESLEGDGGRIVLGHATKSFPSSPSKGGACP
SRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAATAGPEPSPATTAAQEGQPKVHRARKT
MSKPSNGQPPIPEKRPPEVQHFRMSDDMHLGKVTSDVAKRRKLNSGSLSEDLGSAGGSGD
IILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERVDSDSKSEVEALAEQLSEEEEEEEEE
EEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRA
KEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGFEELPLCS
CRMEAPKIDRISERAGHKCMATESVDGELLGCNAAILKRETMRPSSRVALMVLCEAHRAR
MVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVT
IPRGDGGTPPIGTAAPALPPLAHDAPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSG
PSLTLPNGGCLSAVGLPPGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVI
LMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVV
NNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWT
PIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAV
NYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKL
RLGVGNRAVRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRN
ITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRSC
KNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLF
DLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTG
EELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPDLSSLPP
INT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50202440
n/a
NameBDBM50202440
Synonyms:CHEMBL3933828
TypeSmall organic molecule
Emp. Form.C30H31F6N3O2
Mol. Mass.579.5765
SMILESCN(C)C(=O)Nc1ccc(CN2CCC(CC2)C(O)(c2ccc(cc2)C(F)(F)F)c2ccc(cc2)C(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: