Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 3
LigandBDBM50202469
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1624212
EC50 1600±n/a nM
Citation Morikawa THachiman IMatsuo KNishida ENinomiya KHayakawa TYoshie OMuraoka ONakayama T Neolignans from the Arils of Myristica fragrans as Potent Antagonists of CC Chemokine Receptor 3. J Nat Prod 79:2005-13 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 3
Name:C-C chemokine receptor type 3
Synonyms:C-C CKR-3 | C-C chemokine receptor type 3 (CCR3) | CC-CKR-3 | CCR-3 | CCR3 | CD_antigen=CD193 | CKR3 | Eosinophil eotaxin receptor
Type:Enzyme
Mol. Mass.:41053.88
Organism:Homo sapiens (Human)
Description:P51677
Residue:355
Sequence:
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50202469
n/a
NameBDBM50202469
Synonyms:CHEMBL3906647
TypeSmall organic molecule
Emp. Form.C21H24O5
Mol. Mass.356.4123
SMILESCOc1cc(\C=C\C)cc2[C@@H](C)[C@@H](Oc12)c1cc(OC)c(O)c(OC)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: