Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-activated inward rectifier potassium channel 4
LigandBDBM50202481
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1624369
IC50 4900±n/a nM
Citation Vasas AForgo POrvos PTálosi LCsorba APinke GHohmann J Myrsinane, Premyrsinane, and Cyclomyrsinane Diterpenes from Euphorbia falcata as Potassium Ion Channel Inhibitors with Selective G Protein-Activated Inwardly Rectifying Ion Channel (GIRK) Blocking Effects. J Nat Prod 79:1990-2004 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-activated inward rectifier potassium channel 4
Name:G protein-activated inward rectifier potassium channel 4
Synonyms:CIR | Cardiac inward rectifier | GIRK-4 | GIRK4 | Heart KATP channel | IRK-4 | Inward rectifier K(+) channel Kir3.4 | KATP-1 | KCNJ5 | Potassium channel, inwardly rectifying subfamily J member 5
Type:PROTEIN
Mol. Mass.:47658.06
Organism:Homo sapiens (Human)
Description:ChEMBL_107914
Residue:419
Sequence:
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50202481
n/a
NameBDBM50202481
Synonyms:CHEMBL3901192
TypeSmall organic molecule
Emp. Form.C39H49NO14
Mol. Mass.755.8047
SMILES[H][C@@]12C[C@](C)(OC(C)=O)[C@]1([H])[C@@]1([H])[C@@]3(C)OC[C@@]1([C@H](OC(C)=O)[C@@]1([H])[C@@H](OC(=O)c4cccnc4)[C@@H](C)C[C@]1(OC(C)=O)[C@H]3OC(C)=O)C(=O)[C@@H]2OC(=O)C(C)CC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: