Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM50198338
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1625178
Ki 0.389045±n/a nM
Citation Silva ROde Oliveira ASNunes Lemes LFde Camargo Nascente LCoelho do Nascimento Nogueira PSilveira ERBrand GDVistoli GCilia APoggesi EBuccioni MMarucci GBolognesi MLRomeiro LAS Synthesis and structure-activity relationships of novel arylpiperazines as potent antagonists ofa1-adrenoceptor. Eur J Med Chem 122:601-610 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1A adrenergic receptor
Name:Alpha-1A adrenergic receptor
Synonyms:ADRA1A | ADRA1C | Adrenergic alpha1A | Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha adrenergic receptor 1a | Alpha-1C adrenergic receptor | Alpha-adrenergic receptor 1c | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1 | adrenergic Alpha1C
Type:Cell-surface receptors
Mol. Mass.:51511.67
Organism:Homo sapiens (Human)
Description:P35348
Residue:466
Sequence:
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50198338
n/a
NameBDBM50198338
Synonyms:CHEMBL3938038
TypeSmall organic molecule
Emp. Form.C22H28N2O3
Mol. Mass.368.4693
SMILESCC(C)Oc1ccccc1N1CCN(CCc2ccc3OCOc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: