Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInward rectifier potassium channel 13
LigandBDBM50204281
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1627131
IC50>100000±n/a nM
Citation Zhu Yde Jesus RKTang HWalsh SPJiang JGu XTeumelsan NShahripour APio BDing FXHa SPriest BTSwensen AMAlonso-Galicia MFelix JPBrochu RMBailey TThomas-Fowlkes BZhou XPai LYHampton CHernandez MOwens KEhrhart JRoy SKaczorowski GJYang LParmee ERSullivan KGarcia MLPasternak A Discovery of a potent and selective ROMK inhibitor with improved pharmacokinetic properties based on an octahydropyrazino[2,1-c][1,4]oxazine scaffold. Bioorg Med Chem Lett 26:5695-5702 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inward rectifier potassium channel 13
Name:Inward rectifier potassium channel 13
Synonyms:Inward rectifier K(+) channel Kir7.1 | KCNJ13 | Potassium channel, inwardly rectifying subfamily J member 13
Type:PROTEIN
Mol. Mass.:40527.12
Organism:Homo sapiens (Human)
Description:ChEMBL_105176
Residue:360
Sequence:
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204281
n/a
NameBDBM50204281
Synonyms:CHEMBL3933749
TypeSmall organic molecule
Emp. Form.C23H23FN8O2
Mol. Mass.462.4795
SMILES[H][C@]12CO[C@@H](CN1CCN(C2)C(=O)Cc1ccc(cn1)-n1cnnn1)c1ccc(F)c(C#N)c1C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: