Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphorylase kinase
LigandBDBM50204290
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1627213
IC50 226±n/a nM
Citation Lam BArikawa YCramlett JDong Qde Jong RFeher VGrimshaw CEFarrell PJHoffman IDJennings AJones BMatuszkiewicz JMiura JMiyake HNatala SRShi LTakahashi MTaylor EWyrick CYano JZalevsky JNie Z Discovery of TAK-659 an orally available investigational inhibitor of Spleen Tyrosine Kinase (SYK). Bioorg Med Chem Lett 26:5947-5950 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphorylase kinase
Name:Phosphorylase kinase
Synonyms:PHKG2 | Phosphorylase kinase gamma subunit 2
Type:PROTEIN
Mol. Mass.:46440.15
Organism:Homo sapiens (Human)
Description:ChEMBL_774277
Residue:406
Sequence:
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204290
n/a
NameBDBM50204290
Synonyms:CHEMBL3979920
TypeSmall organic molecule
Emp. Form.C17H21FN6O
Mol. Mass.344.3866
SMILESCn1cc(cn1)-c1nc(N[C@@H]2CCCC[C@@H]2N)c(F)c2CNC(=O)c12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: