Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificty protein kinase CLK1
LigandBDBM50204644
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1627842
IC50 1000±n/a nM
Citation Lawson MRodrigo JBaratte BRobert TDelehouzé CLozach ORuchaud SBach SBrion JDAlami MHamze A Synthesis, biological evaluation and molecular modeling studies of imidazo[1,2-a]pyridines derivatives as protein kinase inhibitors. Eur J Med Chem 123:105-114 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificty protein kinase CLK1
Name:Dual specificity protein kinase CLK1/CLK4
Synonyms:CDC-like kinase 1 | CDC-like kinase 1 (CLK1) | CDC2-like kinase 1 (CLK1) | Dual specificity protein kinase CLK1
Type:Protein
Mol. Mass.:57322.21
Organism:Homo sapiens (Human)
Description:P49759
Residue:484
Sequence:
MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESR
SINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL
KKSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204644
n/a
NameBDBM50204644
Synonyms:CHEMBL3935442
TypeSmall organic molecule
Emp. Form.C14H11N3O2
Mol. Mass.253.256
SMILESNC(=O)c1cc(ccc1O)-c1cn2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: