Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4B
LigandBDBM50205606
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1628442
IC50>30000±n/a nM
Citation Guariento SKarawajczyk ABull JAMarchini GBielska MIwanowa XBruno OFossa PGiordanetto F Design and synthesis of 4,5,6,7-tetrahydro-1H-1,2-diazepin-7-one derivatives as a new series of Phosphodiesterase 4 (PDE4) inhibitors. Bioorg Med Chem Lett 27:24-29 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Synonyms:DPDE4 | Isoform PDE4B1 | PDE32 | PDE4B1 | Phosphodiesterase 4B | Phosphodiesterase 4B (PDE4B) | Phosphodiesterase 4B (PDE4B1) | Phosphodiesterase Type 4 (PDE4B)
Type:Protein
Mol. Mass.:83318.87
Organism:Homo sapiens (Human)
Description:Q07343-1
Residue:736
Sequence:
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50205606
n/a
NameBDBM50205606
Synonyms:CHEMBL3945980
TypeSmall organic molecule
Emp. Form.C12H14N2O2
Mol. Mass.218.2518
SMILESCOc1ccc(cc1)C1=NNC(=O)CCC1 |t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: