Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50206088 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1628621 (CHEMBL3871206) |
---|
Ki | 1370±n/a nM |
---|
Citation | Cisneros, JA; Robertson, MJ; Mercado, BQ; Jorgensen, WL Systematic Study of Effects of Structural Modifications on the Aqueous Solubility of Drug-like Molecules. ACS Med Chem Lett8:124-127 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM50206088 |
---|
n/a |
---|
Name | BDBM50206088 |
Synonyms: | CHEMBL3945050 |
Type | Small organic molecule |
Emp. Form. | C19H14N4O3 |
Mol. Mass. | 346.3395 |
SMILES | OC(=O)COc1ccc2nc(ccc2c1)-c1cn(nn1)-c1ccccc1 |
Structure |
|