Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine 3-monooxygenase
LigandBDBM50072082
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1629193
IC50 0.500000±n/a nM
Citation Amin SAAdhikari NJha TGayen S First molecular modeling report on novel arylpyrimidine kynurenine monooxygenase inhibitors through multi-QSAR analysis against Huntington's disease: A proposal to chemists! Bioorg Med Chem Lett 26:5712-5718 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine 3-monooxygenase
Name:Kynurenine 3-monooxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55831.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1487479
Residue:486
Sequence:
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI
SNLISR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072082
n/a
NameBDBM50072082
Synonyms:CHEMBL3407865
TypeSmall organic molecule
Emp. Form.C11H7ClN2O2
Mol. Mass.234.638
SMILESOC(=O)c1cc(ncn1)-c1cccc(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: