Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRC
LigandBDBM50206819
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1629292
Ki 80±n/a nM
Citation Morioka M 3-Cyano-6-(5-methyl-3-pyrazoloamino) pyridines (Part 2): A dual inhibitor of Aurora kinase and tubulin polymerization. Bioorg Med Chem Lett 26:5860-5862 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SRC
Name:SRC
Synonyms:5-HT6 | FYN | HTR6 | Tyrosine Kinase FYN | Tyrosine-protein kinase Fyn | Tyrosine-protein kinase Fyn (Fyn)
Type:Enzyme
Mol. Mass.:60762.21
Organism:Homo sapiens (Human)
Description:P06241
Residue:537
Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50206819
n/a
NameBDBM50206819
Synonyms:CHEMBL3893914
TypeSmall organic molecule
Emp. Form.C19H21N7O
Mol. Mass.363.4163
SMILESCc1cc(Nc2cc(C)c(C#N)c(NCCOc3ccc(C)nc3)n2)n[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: