| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lysozyme C |
|---|
| Ligand | BDBM50207301 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1630606 (CHEMBL3873312) |
|---|
| pH | 2.5±n/a |
|---|
| IC50 | 12300±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Ramshini, H; Mannini, B; Khodayari, K; Ebrahim-Habibi, A; Moghaddasi, AS; Tayebee, R; Chiti, F Bis(indolyl)phenylmethane derivatives are effective small molecules for inhibition of amyloid fibril formation by hen lysozyme. Eur J Med Chem124:361-371 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Lysozyme C |
|---|
| Name: | Lysozyme C |
|---|
| Synonyms: | FvD1.3(VLW92A) | FvD1.3(VLW92D) | FvD1.3(VLW92F) | FvD1.3(VLW92H) | FvD1.3(VLW92S) | FvD1.3(VLW92V) | FvD1.3(VLW92wt) | LYSC_CHICK | LYZ | Lysozyme (hen egg) | hen egg lysozyme (HEL) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 16248.07 |
|---|
| Organism: | Gallus gallus (chicken) |
|---|
| Description: | P00698 |
|---|
| Residue: | 147 |
|---|
| Sequence: | MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG
NGMNAWVAWRNRCKGTDVQAWIRGCRL
|
|
|
|---|
| BDBM50207301 |
|---|
| n/a |
|---|
| Name | BDBM50207301 |
|---|
| Synonyms: | CHEMBL3928463 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H18N2 |
|---|
| Mol. Mass. | 322.4024 |
|---|
| SMILES | c1cc2ccccc2n1C(c1ccccc1)n1ccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
