| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50207335 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1630871 (CHEMBL3873577) |
|---|
| IC50 | 3.2±n/a nM |
|---|
| Citation |  Muthukaman, N; Deshmukh, S; Sarode, N; Tondlekar, S; Tambe, M; Pisal, D; Shaikh, M; Kattige, VG; Honnegowda, S; Karande, V; Kulkarni, A; Jadhav, SB; Mahat, MYA; Gudi, GS; Khairatkar-Joshi, N; Gharat, LA Discovery of 2-((2-chloro-6-fluorophenyl)amino)-N-(3-fluoro-5-(trifluoromethyl)phenyl)-1-methyl-7,8-dihydro-1H-[1,4]dioxino[2',3':3,4]benzo[1,2-d]imidazole-5-carboxamide as potent, selective and efficacious microsomal prostaglandin E Bioorg Med Chem Lett26:5977-5984 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50207335 |
|---|
| n/a |
|---|
| Name | BDBM50207335 |
|---|
| Synonyms: | CHEMBL3961834 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H21ClF4N4O2 |
|---|
| Mol. Mass. | 532.917 |
|---|
| SMILES | Cn1c(Nc2c(F)cccc2Cl)nc2cc(C(=O)Nc3ccc(cc3)C(F)(F)F)c3OC(C)(C)Cc3c12 |
|---|
| Structure | 
|
|---|
Search and Browse
