Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic triacylglycerol lipase
LigandBDBM24567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1631106
Ki 9800±n/a nM
Citation Sridhar SNGinson GVenkataramana Reddy POTantak MPKumar DPaul AT Synthesis, evaluation and molecular modelling studies of 2-(carbazol-3-yl)-2-oxoacetamide analogues as a new class of potential pancreatic lipase inhibitors. Bioorg Med Chem 25:609-620 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic triacylglycerol lipase
Name:Pancreatic triacylglycerol lipase
Synonyms:PL | PTL | Pancreatic triacylglycerol lipase
Type:Enzyme
Mol. Mass.:50080.69
Organism:Sus scrofa (Pig)
Description:P00591
Residue:450
Sequence:
SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTI
TNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQ
NIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAE
PCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQK
NILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPC
PSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSL
FGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNNNVINPTLPRVGASK
ITVERNDGKVYDFCSQETVREEVLLTLNPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24567
n/a
NameBDBM24567
Synonyms:(2S)-1-[(2S,3S)-3-hexyl-4-oxooxetan-2-yl]tridecan-2-yl (2S)-2-formamido-4-methylpentanoate | CHEMBL175247 | Orlistat | THLP | Tetrahydrolipstatin | US9328123, Orlistat | Xenical
TypeSmall organic molecule
Emp. Form.C29H53NO5
Mol. Mass.495.7348
SMILESCCCCCCCCCCC[C@@H](C[C@@H]1OC(=O)[C@H]1CCCCCC)OC(=O)[C@H](CC(C)C)NC=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: