Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 5A |
---|
Ligand | BDBM50207400 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1631229 (CHEMBL3873935) |
---|
Ki | >6900000±n/a nM |
---|
Citation | Blanco, MJ; Benesh, DR; Knobelsdorf, JA; Khilevich, A; Cortez, GS; Mokube, F; Aicher, TD; Groendyke, TM; Marmsater, FP; Tang, TP; Johnson, KW; Clemens-Smith, A; Muhlhauser, MA; Swanson, S; Catlow, J; Emkey, R; Johnson, MP; Schkeryantz, JM Discovery of dual positive allosteric modulators (PAMs) of the metabotropic glutamate 2 receptor and CysLT1 antagonists for treating migraine headache. Bioorg Med Chem Lett27:323-328 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 5A |
---|
Name: | 5-hydroxytryptamine receptor 5A |
Synonyms: | 5-HT-5 | 5-HT-5A | 5-hydroxytryptamine receptor 5 (5-HT5) | 5-hydroxytryptamine receptor 5A (5-HT5A) | 5HT5A_HUMAN | HTR5A | Serotonin (5-HT) receptor | Serotonin receptor 5A |
Type: | Enzyme |
Mol. Mass.: | 40266.25 |
Organism: | Homo sapiens (Human) |
Description: | P47898 |
Residue: | 357 |
Sequence: | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
|
|
|
BDBM50207400 |
---|
n/a |
---|
Name | BDBM50207400 |
Synonyms: | CHEMBL3899832 |
Type | Small organic molecule |
Emp. Form. | C22H19N5O4 |
Mol. Mass. | 417.4174 |
SMILES | CC(=O)c1ccc(OCc2ccc(Oc3cc(ccn3)-c3nn[nH]n3)cc2)c(C)c1O |
Structure |
|