| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 4 |
|---|
| Ligand | BDBM50207400 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1631228 (CHEMBL3873934) |
|---|
| Ki | >6310000±n/a nM |
|---|
| Citation |  Blanco, MJ; Benesh, DR; Knobelsdorf, JA; Khilevich, A; Cortez, GS; Mokube, F; Aicher, TD; Groendyke, TM; Marmsater, FP; Tang, TP; Johnson, KW; Clemens-Smith, A; Muhlhauser, MA; Swanson, S; Catlow, J; Emkey, R; Johnson, MP; Schkeryantz, JM Discovery of dual positive allosteric modulators (PAMs) of the metabotropic glutamate 2 receptor and CysLT1 antagonists for treating migraine headache. Bioorg Med Chem Lett27:323-328 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 4 |
|---|
| Name: | 5-hydroxytryptamine receptor 4 |
|---|
| Synonyms: | 5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | 5-hydroxytryptamine receptor 4 (5-HT4) | 5HT4R_HUMAN | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43767.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13639 |
|---|
| Residue: | 388 |
|---|
| Sequence: | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
|
|
|
|---|
| BDBM50207400 |
|---|
| n/a |
|---|
| Name | BDBM50207400 |
|---|
| Synonyms: | CHEMBL3899832 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H19N5O4 |
|---|
| Mol. Mass. | 417.4174 |
|---|
| SMILES | CC(=O)c1ccc(OCc2ccc(Oc3cc(ccn3)-c3nn[nH]n3)cc2)c(C)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
