Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGhrelin receptor
LigandBDBM50207516
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1632021
IC50 6500±n/a nM
Citation Wood MRNoetzel MJPoslusney MSMelancon BJTarr JCLamsal AChang SLuscombe VBWeiner RLCho HPBubser MJones CKNiswender CMWood MWEngers DWBrandon NJDuggan MEConn PJBridges TMLindsley CW Challenges in the development of an M Bioorg Med Chem Lett 27:171-175 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ghrelin receptor
Name:Ghrelin receptor
Synonyms:GH-releasing peptide receptor | GHRP | GHS-R | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor 1a (GHS-R1a)
Type:Receptor
Mol. Mass.:41334.57
Organism:Homo sapiens (Human)
Description:Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a.
Residue:366
Sequence:
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207516
n/a
NameBDBM50207516
Synonyms:CHEMBL3942511
TypeSmall organic molecule
Emp. Form.C16H15F5N4OS2
Mol. Mass.438.439
SMILESCc1nnc2sc(C(=O)NCc3ccc(cc3)S(F)(F)(F)(F)F)c(N)c2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: