Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; serotonin & dopamine
LigandBDBM50207463
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1632018
IC50 175±n/a nM
Citation Wood MRNoetzel MJPoslusney MSMelancon BJTarr JCLamsal AChang SLuscombe VBWeiner RLCho HPBubser MJones CKNiswender CMWood MWEngers DWBrandon NJDuggan MEConn PJBridges TMLindsley CW Challenges in the development of an M Bioorg Med Chem Lett 27:171-175 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; serotonin & dopamine
Name:Monoamine transporters; serotonin & dopamine
Synonyms:DA transporter | DAT | DAT1 | Dopamine transporter (DAT) | Dopamine transporter protein (DAT) | SLC6A3 | Sodium-dependent dopamine transporter (DAT) | Solute carrier family 6 member 3
Type:Multi-pass membrane protein
Mol. Mass.:68497.11
Organism:Homo sapiens (Human)
Description:Q01959
Residue:620
Sequence:
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207463
n/a
NameBDBM50207463
Synonyms:CHEMBL3963788
TypeSmall organic molecule
Emp. Form.C17H16F2N4O3S2
Mol. Mass.426.461
SMILESCc1nnc2sc(C(=O)NCc3ccc(cc3)S(=O)(=O)C(F)F)c(N)c2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: