Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 3A
LigandBDBM50207463
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1632020
IC50 1600±n/a nM
Citation Wood MRNoetzel MJPoslusney MSMelancon BJTarr JCLamsal AChang SLuscombe VBWeiner RLCho HPBubser MJones CKNiswender CMWood MWEngers DWBrandon NJDuggan MEConn PJBridges TMLindsley CW Challenges in the development of an M Bioorg Med Chem Lett 27:171-175 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 3A
Name:Serotonin 3 (5-HT3) receptor
Synonyms:5-HT-3 | 5-HT3 | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 (5-HT3) | 5-hydroxytryptamine receptor 3A (5-HT3a) | 5-hydroxytryptamine receptor 3A (5HT3A) | HTR3A | Serotonin 3 (5-HT3) receptor | Serotonin 3 receptor (5HT3) | Serotonin receptor 3A | Serotonin-gated ion channel receptor | Serotonin-gated ion channel receptor 3
Type:Protein
Mol. Mass.:55283.27
Organism:Homo sapiens (Human)
Description:P46098
Residue:478
Sequence:
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207463
n/a
NameBDBM50207463
Synonyms:CHEMBL3963788
TypeSmall organic molecule
Emp. Form.C17H16F2N4O3S2
Mol. Mass.426.461
SMILESCc1nnc2sc(C(=O)NCc3ccc(cc3)S(=O)(=O)C(F)F)c(N)c2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: