Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinesterases
LigandBDBM50208216
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1632485
IC50 6.2±n/a nM
Citation Wieckowska AKolaczkowski MBucki AGodyn JMarcinkowska MWieckowski KZareba PSiwek AKazek GGluch-Lutwin MMierzejewski PBienkowski PSienkiewicz-Jarosz HKnez DWichur TGobec SMalawska B Novel multi-target-directed ligands for Alzheimer's disease: Combining cholinesterase inhibitors and 5-HT Eur J Med Chem 124:63-81 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholinesterases
Name:Cholinesterases; ACHE & BCHE
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase (human AChE)
Type:Enzyme
Mol. Mass.:67792.70
Organism:Homo sapiens (Human)
Description:P22303
Residue:614
Sequence:
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208216
n/a
NameBDBM50208216
Synonyms:CHEMBL3884690
TypeSmall organic molecule
Emp. Form.C38H45N5O2S
Mol. Mass.635.861
SMILESO=S(=O)(c1ccccc1)n1ccc2c(cccc12)N1CCN(CCCCCCCNc2c3CCCCc3nc3ccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: