Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinesterase
LigandBDBM50208255
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1632481
IC50 3394±n/a nM
Citation Wieckowska AKolaczkowski MBucki AGodyn JMarcinkowska MWieckowski KZareba PSiwek AKazek GGluch-Lutwin MMierzejewski PBienkowski PSienkiewicz-Jarosz HKnez DWichur TGobec SMalawska B Novel multi-target-directed ligands for Alzheimer's disease: Combining cholinesterase inhibitors and 5-HT Eur J Med Chem 124:63-81 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholinesterase
Name:Cholinesterase
Synonyms:Cholinesterase
Type:Enzyme
Mol. Mass.:65643.35
Organism:Equus caballus (Horse)
Description:P81908
Residue:574
Sequence:
EEDIIITTKNGKVRGMNLPVLGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSNIWNATK
YANSCYQNTDQSFPGFLGSEMWNPNTELSEDCLYLNVWIPAPKPKNATVMIWIYGGGFQT
GTSSLPVYDGKFLARVERVIVVSMNYRVGALGFLALSENPEAPGNMGLFDQQLALQWVQK
NIAAFGGNPRSVTLFGESAGAASVSLHLLSPRSQPLFTRAILQSGSSNAPWAVTSLYEAR
NRTLTLAKRMGCSRDNETEMIKCLRDKDPQEILLNEVFVVPYDTLLSVNFGPTVDGDFLT
DMPDTLLQLGQFKRTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPR
VSEFGRESILFHYMDWLDDQRAENYREALDDVVGDYNIICPALEFTRKFSELGNDAFFYY
FEHRSTKLPWPEWMGVMHGYEIEFVFGLPLERRVNYTRAEEILSRSIMKRWANFAKYGNP
NGTQNNSTRWPVFKSTEQKYLTLNTESPKVYTKLRAQQCRFWTLFFPKVLELTGNIDEAE
REWKAGFHRWNNYMMDWKNQFNDYTSKKESCSDF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208255
n/a
NameBDBM50208255
Synonyms:CHEMBL3885238
TypeSmall organic molecule
Emp. Form.C31H37N5O2S
Mol. Mass.543.723
SMILESO=S(=O)(c1ccccc1)n1ccc2c(cccc12)N1CCN(CCNC2CCN(Cc3ccccc3)C2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: