Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 1A (PDE1A)
LigandBDBM50208311
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1632640
IC50>1±n/a nM
Citation Zhou ZZGe BCZhong QPHuang CCheng YFYang XMWang HTXu JP Development of highly potent phosphodiesterase 4 inhibitors with anti-neuroinflammation potential: Design, synthesis, and structure-activity relationship study of catecholamides bearing aromatic rings. Eur J Med Chem 124:372-379 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 1A (PDE1A)
Name:Phosphodiesterase 1A (PDE1A)
Synonyms:Calmodulin-dependent phosphodiesterase | Phosphodiesterase 1 | Phosphodiesterase 1B (PDE1B)
Type:Protein
Mol. Mass.:61245.69
Organism:Homo sapiens (Human)
Description:P54750
Residue:535
Sequence:
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208311
n/a
NameBDBM50208311
Synonyms:CHEMBL3885161
TypeSmall organic molecule
Emp. Form.C18H18F2N2O3
Mol. Mass.348.3439
SMILESFC(F)Oc1ccc(cc1OC1CCCC1)C(=O)Nc1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: