Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 6C (PDE6C)
LigandBDBM50208315
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1632649
IC50>1±n/a nM
Citation Zhou ZZGe BCZhong QPHuang CCheng YFYang XMWang HTXu JP Development of highly potent phosphodiesterase 4 inhibitors with anti-neuroinflammation potential: Design, synthesis, and structure-activity relationship study of catecholamides bearing aromatic rings. Eur J Med Chem 124:372-379 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 6C (PDE6C)
Name:3',5'-cyclic phosphodiesterase
Synonyms:Phosphodiesterase 6C
Type:Protein
Mol. Mass.:99132.02
Organism:Homo sapiens (Human)
Description:P51160
Residue:858
Sequence:
MGEINQVAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRSRNGIPEVASRLLDVTPT
SKFEDNLVGPDKEVVFPLDIGIVGWAAHTKKTHNVPDVKKNSHFSDFMDKQTGYVTKNLL
ATPIVVGKEVLAVIMAVNKVNASEFSKQDEEVFSKYLNFVSIILRLHHTSYMYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRSYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVNFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEY
ITETLTQFLGWSLLNTDTYDKMNKLENRKDIAQEMLMNQTKATPEEIKSILKFQEKLNVD
VIDDCEEKQLVAILKEDLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKA
AEDSGGGDDKKSKTCLML
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208315
n/a
NameBDBM50208315
Synonyms:CHEMBL3884224
TypeSmall organic molecule
Emp. Form.C17H16F2N2O3
Mol. Mass.334.3173
SMILESFC(F)Oc1ccc(cc1OCC1CC1)C(=O)Nc1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: